SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009197 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009197
Domain Number 1 Region: 519-759
Classification Level Classification E-value
Superfamily Ras GEF 2.48e-35
Family Ras GEF 0.0095
Further Details:      
 
Domain Number 2 Region: 139-257
Classification Level Classification E-value
Superfamily SH2 domain 9.96e-25
Family SH2 domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009197   Gene: ENSMICG00000010096   Transcript: ENSMICT00000010096
Sequence length 823
Comment pep:novel genescaffold:micMur1:GeneScaffold_2088:84353:188860:-1 gene:ENSMICG00000010096 transcript:ENSMICT00000010096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGKFASLPRNMPVNHQFPLASSMDLLSSKSPLAEHRSDAYQDVSIHGTLPRKKKGPPP
IRSSESFSHVGTLPHAKSPRQNSPLTQDVIQENPLQDWKTETFSFRDPHPMDPTLEYVKF
SKERHVMDRTPERLKKELEEELLLSSEDLRSHAWYHGRIPRQVSENLVQRDGDFLVRDSL
SSPGNFVLTCQWKNLAQHFKIHRTVLRLSEAYSRVQYQFEMESFDSIPGLVRCYVGNRRP
VSQQSGAIIFQPVNRTVPLRCLEERYGTSPGRAREGSLAEGRPDVTKRLSFTMGSAQARE
QNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPSQSPGVDASPC
PSSPVFRTGSEPTLSPAVVRRVSSDARPGEALRGSDSQLCPKPPPKPCKVPFLKAPSSPP
ARPNSEANYCELNPAFAAGCDQGARLPLCARGSRPELLTAKRHGAPGPRNSGINYSILDG
DDGARPWEPPAAQVDKEDEGTFVKPLLETVSSFRPNDFESKLLPAENKPLETAMLKRAKE
LFTSSGPKVIAQHMLSVDCKVARILEVSEETRRNMGVSSGLELITLPHGHQLRLDIIERH
NTMAIGIAVDVLGCTGTLEERAATLNRIIQVAVELKDSMGDLYSFSAVMKALEMPQITRL
EKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCVPPSNISVPLLMPLVTLMERQAV
TFEGTDMWEKNDQSCEIMLNHLATARFMAEAADSYRVNAERNLAGFQPDEEMSEIFKTEF
QMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL
Download sequence
Identical sequences ENSMICP00000009197 XP_012646403.1.48125 XP_012646404.1.48125 XP_012646405.1.48125 ENSMICP00000009197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]