SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009931 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009931
Domain Number 1 Region: 976-1089
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.53e-19
Family Synaptotagmin-like (S variant) 0.014
Further Details:      
 
Domain Number 2 Region: 19-73
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000224
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.002
Further Details:      
 
Domain Number 3 Region: 198-285
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000312
Family Synaptotagmin-like (S variant) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009931   Gene: ENSMICG00000010884   Transcript: ENSMICT00000010900
Sequence length 1130
Comment pep:novel genescaffold:micMur1:GeneScaffold_2077:105057:422891:1 gene:ENSMICG00000010884 transcript:ENSMICT00000010900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMHVFKKTLQALIYPMSSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCH
EKCQDLLNADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIREKNRPEVFEVIQEMFQIS
KEDFVQYTKAAKQSVLDGTSKWSAKITITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEV
RTLSGEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTE
VKSNGGVKIPDVKGDEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPG
VPAVMSTLLANINAFYAHTTVSTNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSK
YRDNFLASNTERLQDLKSTVDLLTXXVLELQSPKASTVVKDCVRACLDSTYKYIFDNCHE
LYSQLIDPSKRQDIPREDQGPTTKNLDFWPQLITLMVTIIDEDKTSYTPVLNQFPQELNM
GKISAEIMWTLFALDMKYALEEHEKQRLCKSTDYMNLHFKVKWFYNEYVRELPAFKDAVP
EYSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKXXXXXXXXXXXXXXXXXXXXXXXXXX
XEIIKKLECPNPETLSHLMRRFAKTINKVLLQYAAIVSSDFSSYCDKENVPCILMNNIQQ
LRVQLEKMFESMGGKELDPEASTILKELQVKLNGVLDELSVIYGESFQLIIEECIKQMSF
ELNQMRANGNTTSNKNSAAMDAEIVLRPLMDFLDKTLSLSAKICEKTVLKRVLKELWKLV
LNKIEKQIVLPPLTDQTGPQMIFIAAKDIGQLSKLKEHMIRDDDKGLTRQCAVXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQXXXXXXXXX
XXXXXXXXXXXXXXXEHKVTVKVIAINDLSWQTTAMFRPFVEVCILGPNLGDKKRKQGTK
TKSNTWSPKYNETFQXXXXXXXXXXXXXIHLSVKDYCFAREDRIIGMTVIQLQNIAEKGS
YGAWYPLLKNISMDETGLTILRILSQRTGDDVAKEFVRLKSETRSPEESA
Download sequence
Identical sequences ENSMICP00000009931 ENSMICP00000009931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]