SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011148 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011148
Domain Number 1 Region: 81-283,332-419,451-476
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.05e-54
Family Diacylglycerol kinase-like 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000011148
Domain Number - Region: 27-75
Classification Level Classification E-value
Superfamily PH domain-like 0.0188
Family Pleckstrin-homology domain (PH domain) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011148   Gene: ENSMICG00000012238   Transcript: ENSMICT00000012245
Sequence length 489
Comment pep:novel genescaffold:micMur1:GeneScaffold_407:40440:62293:-1 gene:ENSMICG00000012238 transcript:ENSMICT00000012245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AWSVPVAEIIAVEETDGKLGGGGAGRWQKMETPFAFTVHCVKRARHHRWKWAQVTFCCPE
EQLCRLWLQTLRAMLEALTSRPKHLLVFINPIGGKRKGKRVYEQKVAPLFALASITADVI
VTEHANQAKETLYEINLESYDGIVCVGGDGMFSEVLHGLVGRTQRSAGVDQDHPRAALAP
SGLRIGIIPAGSTDCVCYSTXXXXXXXXXXXXXXXXDSLAMDVSSVHHGGTLLRYSVSLL
GYGFYGDIIRDSEKKRWMGLARYDFSGIKTFLSHHCYEGTVSFLPAQHTVGSPRDGKPCR
AGCSVCRQSRQQLQEEQKKALYGLENAEEVEEWQVVCGKFLAINVTNMSCACRRSPQGLS
PAAHLGDGSCDLILIRKCSRFNFLRFLLRHTNQCDQFDFSFVEVYRVRKFQFTSKHAGDE
DSDLQEGGKARFAHICREHPSCCCEASSSSWNCDGEVLHSAAIEVRVHCQLVRLFARGIE
EDPKQAPRS
Download sequence
Identical sequences ENSMICP00000011148 ENSMICP00000011148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]