SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013215 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013215
Domain Number 1 Region: 72-115,164-282
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000877
Family Nucleotide and nucleoside kinases 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013215   Gene: ENSMICG00000014501   Transcript: ENSMICT00000014499
Sequence length 295
Comment pep:novel genescaffold:micMur1:GeneScaffold_144:1438881:1451522:-1 gene:ENSMICG00000014501 transcript:ENSMICT00000014499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKEKRRHLGDTKHFCPVVLKENFILQPCSTEEAAKYRDKIYYFSSPEAKEKFLEHPEDYV
AHEEPLKVPALRICIVGPHGSVKACGRPLAEKLGIFHIQFEEFLQEKIMLKTEKKVGPEF
EEDLEEELAAKQELEELAIQANVKIEEENAKKQPPELQLTEEEEAIKANLMENDPLPSEI
LDMILSEWWFEEPMRSTGFILDGFPRYPEEALFLGEHGFFPDAVVFIQVDDQDIFDRLLP
PRIEKWKLKQKKKLERRKLIKDMKSKIREDMIAKRRAELMAERDRKKKGEVSTIF
Download sequence
Identical sequences ENSMICP00000013215 ENSMICP00000013215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]