SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013767 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013767
Domain Number 1 Region: 14-196
Classification Level Classification E-value
Superfamily L domain-like 5.67e-38
Family Ngr ectodomain-like 0.025
Further Details:      
 
Domain Number 2 Region: 627-726
Classification Level Classification E-value
Superfamily DEATH domain 4.04e-20
Family DEATH domain, DD 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000013767
Domain Number - Region: 368-410
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.0162
Family Actin/HSP70 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013767   Gene: ENSMICG00000015084   Transcript: ENSMICT00000015096
Sequence length 755
Comment pep:novel genescaffold:micMur1:GeneScaffold_3803:804:6423:-1 gene:ENSMICG00000015084 transcript:ENSMICT00000015096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQCRDALGACLRGALTTLPAGLSGLARLAHLDLSFNSLETLPGCVPQMRGLDALLLSHNC
LSELPEALGALPGLTFLAVTHNRLQTLPTALGALSTLQRLDLSKNLLDTLPPEIGGLGSL
SELNLASNRLQSLPASLAGLRSLRLLLLHSNLLASVPAGLARLPLLTRLDLRDNQLREVP
PELLDAPFVRLQGNPLGEVSADPPSPPGTPPVLEMPRLFLTSYLDSFPVTPRGCSVTLAC
GARLQFPAGATATPITIRYRLLPPEPGLVPLGPHDALLSGVLELQHGRGAADVGLLLFVP
PTRRFREVVRTRTDXXXXXXXXXXXXXXXXRLWAHCQVPHFSWFLVVSRPVSNACLVTPE
GTLLCSSGHPGVKVTFPPGATEEPRRISMQVVHMAGRELRALLGEPGAAVSPLLCLSQSG
PPSFLRPVTVQLPLPSGTTGLSLDRACLHLLYWPPPAATDDITAQVVLELTILYARFQIT
HFPWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRPDCVDGRVCFVFY
SHLKNVKEVYVTTTLDREAQAVRGQVSFYRGTVPVEVPEEAEAARRRKGADALWMATLPI
KLPRLRGSEGQGRRASLSLAPLNLGDAETGFLTQSNLLSVAGRLGPDWPAVALHLGMPYR
ELQRIRHEFRDDLDGQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLEL
GRHKYQDGIRRTGLASEDPAVPGPSPPQSQEPAQA
Download sequence
Identical sequences ENSMICP00000013767 ENSMICP00000013767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]