SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013805 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013805
Domain Number 1 Region: 240-544
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 4.58e-85
Family NAD kinase-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013805   Gene: ENSMICG00000015125   Transcript: ENSMICT00000015136
Sequence length 555
Comment pep:novel genescaffold:micMur1:GeneScaffold_58:3776:15185:-1 gene:ENSMICG00000015125 transcript:ENSMICT00000015136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMEQEKMHVNKELCPESAAYCCSACHGDETWSYSHPIRGRAKSRSLSASPAPGSTKEFR
RTRSLHGPCPVTTFGPKACVLQNPQTIIAAPSTHLAVPPVAVSSGGQDRVGDVCATLHPS
GDGLGAAPRGQTAQQEVTQEVEERVCGHSLLPRPAQAGTGGPGAQLSLGHIQDPASQRLT
WNKAPKSVLVVKKVRDAGLLQPFKELCTYLMEAAAWAGQGGAGRALSARAGTAEVSRLAL
FQENNMVVYVEKKVLEDPAIVSDENFGAVKKKFCTFREDYDDISNQIDFIICLGGDGTLL
YASSLFPGSVPPVMAFHLGSLGFLTPFNFENFQSQVTQVIEGNAAVVLRSRLKVRVVKEP
RGRKVPVPNGLSENGAPAPGQADGGKQVMQYQVLNEVVIDRGPSSYLSNVDVYLDGHLIT
TVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIM
LSPEARNTAWVSFDGRKRQEIRHGDSISITTSRYPLPSICVRDPVSDWFESLAQCLHWNV
RKKQAHFPEEEEGEG
Download sequence
Identical sequences ENSMICP00000013805 ENSMICP00000013805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]