SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013828 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013828
Domain Number 1 Region: 24-104
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000341
Family DEATH effector domain, DED 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013828   Gene: ENSMICG00000015165   Transcript: ENSMICT00000015159
Sequence length 326
Comment pep:novel genescaffold:micMur1:GeneScaffold_967:175120:199845:-1 gene:ENSMICG00000015165 transcript:ENSMICT00000015159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSGSTPAPSWEEDECLDYYGMLSLHRMFEVVGGQLTECELELLAFLLDEAPGAAGGLA
RARSGLELLLELERRGQCDESNLRLLGQLLRVLARHDLLPHLARKRRRPVSPERYSYGTS
SSSKRTEGSCRRRRESSSSSDSHQGQWETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXIRLRVRAEYCEHGPALEQGVASRRPQALARQLDVFGQATAVLR
SRDLGSVVCDIKFSELSYLDAFWGDYLSGALLQALRGVFLTEALREAVGREAVRLLVSVD
EADYEAGRRRLLLMEEEGGRRLTEAS
Download sequence
Identical sequences ENSMICP00000013828 ENSMICP00000013828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]