SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014864 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014864
Domain Number 1 Region: 178-377,531-646
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 8.07e-58
Family Diacylglycerol kinase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014864   Gene: ENSMICG00000016315   Transcript: ENSMICT00000016307
Sequence length 655
Comment pep:novel genescaffold:micMur1:GeneScaffold_269:46619:53082:1 gene:ENSMICG00000016315 transcript:ENSMICT00000016307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGHLEAEEQQDQKPDQELTGSWGHRPRSTLDRAEAMAPPPPPLAASTPLLHGEFGSYPA
RGPRFALTLTSQALHIQRLRPKPEARPRGGVPLAEVSGCCTLRSRSPSNSAAYFCIYTYP
RGRRGGRRRATGTFKADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPELLPRPP
RLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLNLSEWDGI
VTVSGDGLLYEVLNGLLDRPDWEEAVKMPVGILPCGSGNALAGAVNQRGGFEPALGLDLL
LNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLAVAWGFVSDVDIQSERFRALGSARFTLG
TVLGLATLHTYRGRLSYLPATGETASPTPTHGLPRAKSELTLAPDSAPPMAHSPLHRSVS
DLPLPLPLPESALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPK
AALLSPIAEGPPEIPPSSGLPPATPDAPVAMSTWGPPDHLLPPLGTPLPPDWVTVEGDFV
LMLAISPSHLGADMVAAPHARFDDGLVHLCWVRSGISRASLLRLFLAMEHGTHFSLGCPQ
LGYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGLATLLTGPPGCTGREP
Download sequence
Identical sequences ENSMICP00000014864 ENSMICP00000014864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]