SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014908 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014908
Domain Number 1 Region: 44-106
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000123
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0026
Further Details:      
 
Domain Number 2 Region: 203-291
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000775
Family Ras-binding domain, RBD 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014908   Gene: ENSMICG00000016362   Transcript: ENSMICT00000016355
Sequence length 344
Comment pep:novel genescaffold:micMur1:GeneScaffold_14:496196:504414:-1 gene:ENSMICG00000016362 transcript:ENSMICT00000016355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEPELIELRDLAPTGRASPGRTRLERANALRIAPGTARNPARQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCARLSADCKFTCHYRCRALVCLDCCGPRDLGWEPALERD
TNVDEPVEWETPDLSQAEIEQKIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSV
PSSKKPTSLQDARRGPGRGTTVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVV
DDPRKFALFERAERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAF
SMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
Download sequence
Identical sequences ENSMICP00000014908 ENSMICP00000014908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]