SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015933 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015933
Domain Number 1 Region: 268-394
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.1e-25
Family Diacylglycerol kinase-like 0.015
Further Details:      
 
Domain Number 2 Region: 1079-1145
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.86e-19
Family SAM (sterile alpha motif) domain 0.0033
Further Details:      
 
Domain Number 3 Region: 2-64
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000274
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015933   Gene: ENSMICG00000017492   Transcript: ENSMICT00000017492
Sequence length 1153
Comment pep:novel genescaffold:micMur1:GeneScaffold_3624:799509:930788:1 gene:ENSMICG00000017492 transcript:ENSMICT00000017492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEASTKNAN
NSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDEDGX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHTACKDLYHPICPLGQCK
VSIIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFD
LMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQAICQLGVLPLGTGND
LARVLGWGGSYDDDTQLPQILEKLERASTKMLDXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLCETVKDFVAKVEKAYDKTLENAVVADA
VASKCSVLNEKLEQLLQALHTDAQAASVLPGLGPLIVEQYAVESSSEESLGESKEHLTDD
VTKPAFQKAVRPREIMLRANSLKKAVRQVIEEAGKATDDQTVHPCEPATHSSDYDSTETD
ESKDDDIKDSSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRA
GLAASIAGSSIINKMLLANIDPFGATPFIDPEPDSVXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAFENTLKSWEDKQKCD
SGKPVLRTHLYIHPNDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQELAHAVNAC
SHALNKANPRCAEGLTRDTATEIAINVKALYNETESLLVGRVPLQLESPHEERVSNALHS
VEVELQKLTEIPWLYYILHPNEDEEPPMDCTKRNNRSTVFRIVPKFKKEKVQKQKTSSQP
VQKWGTEEVAAWLDLLNLGEYKDTFIRHDIRGAELLHLERRDLKDLGIPKVGHVKRILQG
IKELGRSTPQSEV
Download sequence
Identical sequences ENSMICP00000015933 ENSMICP00000015933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]