SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000016239 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000016239
Domain Number 1 Region: 101-137
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.0000101
Family NAD kinase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000016239   Gene: ENSMICG00000017830   Transcript: ENSMICT00000017830
Sequence length 255
Comment pep:novel genescaffold:micMur1:GeneScaffold_3408:209621:238183:-1 gene:ENSMICG00000017830 transcript:ENSMICT00000017830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEGHLCLPVRYTHSFPEALQKFYRGEFRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXSETSGXXXXXXXXXXXXXXXXXXXXXASYYEISVDDGPWEKQKSSG
LNLCTGTGSKAWSFNINRVAAQAVEDVLSIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCVRSRCWDACMVVDGGTSFEFNDGAIASM
MINKEDELRTVILEQ
Download sequence
Identical sequences ENSMICP00000016239 ENSMICP00000016239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]