SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000602 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000602
Domain Number 1 Region: 449-627
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-51
Family SPRY domain 0.00037
Further Details:      
 
Domain Number 2 Region: 8-77
Classification Level Classification E-value
Superfamily RING/U-box 1.23e-18
Family RING finger domain, C3HC4 0.0091
Further Details:      
 
Domain Number 3 Region: 148-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000229
Family B-box zinc-binding domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000602   Gene: ENSMICG00000000659   Transcript: ENSMICT00000000672
Sequence length 629
Comment pep:novel genescaffold:micMur1:GeneScaffold_2713:94945:114486:-1 gene:ENSMICG00000000659 transcript:ENSMICT00000000672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELYRAEELSCSICLEPFKEPVTTPCGHNFCGSCLSETWAVQGAPYLCPHCRAVYATRP
QLHKNTVLCAVVEQFLQAELAREAPADDGWTPPARAAAPSPSAWVACDHCLKEAAVKTCL
VCMASFCQEHLRPHLDSPAFQDHPLQPPVGDLLRRKCPQHNRLREFFCWEHSECICHICL
VEHKACSPVSLSQASAELETKLRHKITVMYSQINGASRALEDVKTRQQDVRATINKKMEQ
LRQEYMEMKALIEASEATQTRKMKEEEKRVIGKFDAIYQALLKRKGEIQKLKEEIELGLT
KGDELEFLEKASKLQGISTKPVYVTKVELNHELMKGVHQSTVDLKNELKRCLRQLQESTT
GSGDSGEHVPASTHKSSRPAKVSKDEKTSKKHAAPPASASKLPTFGAPEQSVDLKQAGLE
AAAKATNSKATSELLKATVLGNFLAKSRPELLEYYVKVILDYNTAHSKVTLSENYTVASV
ADTPQSYRPHPQRFTSCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMERKGPESR
LGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADKVHLLY
KYKVDFTEAVYPGFWVFSAGGTLTICPRN
Download sequence
Identical sequences ENSMICP00000000602 ENSMICP00000000602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]