SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001690 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001690
Domain Number 1 Region: 1-239
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-61
Family Nuclear receptor ligand-binding domain 0.00000000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001690   Gene: ENSMICG00000001854   Transcript: ENSMICT00000001854
Sequence length 321
Comment pep:novel genescaffold:micMur1:GeneScaffold_3192:278:11031:1 gene:ENSMICG00000001854 transcript:ENSMICT00000001854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQNERDRISTRRSTFDGSNIPSINTLAQAEVRSRQISVSSPGGSTDINVKKIASIGDVCE
SMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMYKDILLLGNNY
VIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLDPVKDMQV
QISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLL
GGASNDGSHFHHPMHPHLSQDPLTGQTILLGPMSTLVHTDQISTPEPLPSPPQGSGQEHY
KIAANQASVISHQPLSKQKPL
Download sequence
Identical sequences ENSMICP00000001690 ENSMICP00000001690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]