SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002099 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002099
Domain Number 1 Region: 408-480
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000138
Family SH2 domain 0.0026
Further Details:      
 
Domain Number 2 Region: 11-54
Classification Level Classification E-value
Superfamily PH domain-like 0.000000656
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002099   Gene: ENSMICG00000002298   Transcript: ENSMICT00000002299
Sequence length 489
Comment pep:novel genescaffold:micMur1:GeneScaffold_577:711:9099:1 gene:ENSMICG00000002298 transcript:ENSMICT00000002299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMRAAEETTSNNVFPFKIVHISKKHRTWFFSASSEDERKSWMALLRREIGHFHEKKELSL
DTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALTH
PPAYPPPPVPVPRKPAFSDMPRAHSFTSKGPSPLLPPVPPKHGLPDAGLVPEDSKRDPLG
LRRVESALRVPATSRRMSDPPLGSVPVAPGLRKPPCFRECASPSLEPWTPGHGASSASSS
AIMAAATSRNCDKLKSFHLSPRGLPTSEPPPVPANKPKFLKPAEEDTPREAARPGLFVPP
VAPRLPALKLPTPEATARPLVLPRPEKPPLPHLQRSPPDGQSFRSFSFEKPRQPSQGDVG
QEDSDEDYEKASPDRLLQVPLPSSVFVNTTESCEVERLFKATSPQGEPQDGLYCIRNSST
KSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLR
HPYGYAGPR
Download sequence
Identical sequences ENSMICP00000002099 ENSMICP00000002099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]