SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002234 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002234
Domain Number 1 Region: 183-433
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.85e-81
Family Eukaryotic proteases 0.00048
Further Details:      
 
Domain Number 2 Region: 103-201
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000301
Family Hepsin, N-terminal domain 0.039
Further Details:      
 
Domain Number 3 Region: 58-94
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000111
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002234   Gene: ENSMICG00000002447   Transcript: ENSMICT00000002448
Sequence length 438
Comment pep:novel genescaffold:micMur1:GeneScaffold_2067:1266758:1306581:1 gene:ENSMICG00000002447 transcript:ENSMICT00000002448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFQEPSSDQPLNNSQDAASLSKPGTRLKTFKKVGIPIISAVVGVMAIVVVVILIKEILES
YYFFCDQPLHFISREQVCNGEPDCSLGEDEKHCVKNIPEGPKMSVRLSKDRSTLQVLDQA
TGNWSSACFDHFTDALANIACRQMGYSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXSCASGSLVSLHCLACGKNLKTPRVVGGEEASVDSWPWQVSIQYDKQHICGGSILDAHW
ILTAAHCFRXXXXXXXXXXXXXSDRLGYSHGLSVSKIIVIELNPIYPKEKDIALIKLKSP
LTFSDTIRPICLPFFDEELAPATPVWVIGWGLTEENGGKMSDILMQASVEVIDSRKCNAE
DSYQGDVTEKMLCAGIPEGGVDSCQGDSGGPLMYQSDQWQVVGIVSWGHGCGSPHAPGVY
TKVAAYLNWIYGVRKAEL
Download sequence
Identical sequences ENSMICP00000002234 ENSMICP00000002234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]