SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003549 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003549
Domain Number 1 Region: 592-739
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.7e-21
Family Protein kinases, catalytic subunit 0.00085
Further Details:      
 
Domain Number 2 Region: 765-842
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.82e-17
Family Protein kinases, catalytic subunit 0.0024
Further Details:      
 
Domain Number 3 Region: 944-1042
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.63e-16
Family Protein kinases, catalytic subunit 0.00064
Further Details:      
 
Domain Number 4 Region: 65-185
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000152
Family Second domain of FERM 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000003549
Domain Number - Region: 332-365
Classification Level Classification E-value
Superfamily SH2 domain 0.00261
Family SH2 domain 0.0073
Further Details:      
 
Domain Number - Region: 203-274
Classification Level Classification E-value
Superfamily PH domain-like 0.00664
Family Third domain of FERM 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003549   Gene: ENSMICG00000003885   Transcript: ENSMICT00000003891
Sequence length 1055
Comment pep:novel genescaffold:micMur1:GeneScaffold_672:10433:87636:1 gene:ENSMICG00000003885 transcript:ENSMICT00000003891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITPVYHNMFALMCETERIWYPPNHVFHIDESTRHNVLYRIRFYFPHWYCSGSNRTYRHGI
SRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLGMAVLDMMRIAKEKDQT
PLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLI
NLETLQSAFYTEQFEVKEPGRGPSGEEIFATIIITGNGGIQWSRGKHKESETLTEQDLQL
YCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAISKLKKAGNQTGLYVLRCSPKDFNKYF
LTFAVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXKSNLLVFRTNGVSDVPTSPALQRHNNVSQMVHKIRNEXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEKILIHGNVCAK
NILLIREEDRKTGNPPFVKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKW
SFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTELANLINNCMDYEPDFRPS
FRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGK
GNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVC
YSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYAPESLTESKFSVASDV
WSFGVVLYELFTYIEKSKSTPTEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDE
IYIIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Download sequence
Identical sequences ENSMICP00000003549 ENSMICP00000003549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]