SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004633 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004633
Domain Number 1 Region: 690-946
Classification Level Classification E-value
Superfamily RNI-like 8.86e-48
Family 28-residue LRR 0.0000648
Further Details:      
 
Domain Number 2 Region: 1323-1409
Classification Level Classification E-value
Superfamily DEATH domain 8.01e-16
Family Caspase recruitment domain, CARD 0.027
Further Details:      
 
Domain Number 3 Region: 4-87
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000836
Family Pyrin domain, PYD 0.00013
Further Details:      
 
Domain Number 4 Region: 293-468
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000239
Family RecA protein-like (ATPase-domain) 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004633   Gene: ENSMICG00000005070   Transcript: ENSMICT00000005079
Sequence length 1421
Comment pep:novel genescaffold:micMur1:GeneScaffold_641:15244:61929:-1 gene:ENSMICG00000005070 transcript:ENSMICT00000005079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRAQLGYYLELLKKEELKEFQLRLHNEEPVPGSSSAMAVPPEKMSGMEVASCLVARYG
EQRAWDLAHHTWRQMGLSLPCGQDQEEEALLLDDFPPFLSFSSTPNLESPSQPTSTAVLR
FCGSESPGHPQVSERKKILRWLPDTSGHPFGEHLSSLLYQALPSSPDHESPSQGSPNAPT
STAVLRGWQSLPQPSLGPRKQEAPGTEWPLAETSGNFHTGMRERPKPERENSCSTLSWKS
EVLHKKFTQLILLKTPHPRIHESLDRRSWHHDMVENQGRLIKMGDLFGPSLGTQEEPRIV
ILHGGAGIGKSTLARQVKRAWEEGQLYRDCFHHIFYFSCRELAQAKVLSLAELITKGSEA
SLAPLGEILSCPERLLFILDGVDEPRWVLEEQSVEFCLHWSQQQPVHALLGSLLGKTVLP
EASLLITTRTTALQKLIPSLEQPRWVEVLGFSDSGRKEYFYNYFTDESQAIRAFGLVESN
RAVWTLCLVPFVSWLVCSCLKQQMEWGEELTLTSQTATGLCLRHLSQALLGQPLGPQLRG
VCLLAAEGVWQGKSLFSQDDLRKHELDEAIISTSLKMGVLQKHYTSPSYSFTHLCFQEFF
AAMSCALGDTEERGEHPNLIRVVERLQEAYQSHDVFGAPTTRFLFGLLTEQARREMENIF
NRQPSLDRRRELLQWAEEESQGQEAPLPSSLEVLHCLYETQDEEFLTQVMAHFQGTSVCV
HTDMELLVFTFCIKFCHHVKRLQLNAGGQHRPTWRPPGVVLFTWAPVTDASWLVFFSVLE
VSGSLKELNLSGNSVSRLAVRSLCETLSHPRCHLETLWLASCGLTAEDCKDLAFGLSASQ
TLTELDLSFNVLRDAGAKHLCQGLRQLSCKLQRLWLVSCGLTSSCCQDLASVLSTSPSLL
ELDLHENDLGDLGVRLLCERVWHPACRLRLLGLDQAPLGEELREHLRALQEEKPQLLIFG
RGKPSMMIPNEHQDEGEMTNNRSSLKRQRPESEGSCPQVAQKVEPFCLSSPASPRDLYME
PLGTKDDFWGPTGPVATEAVDKDRSLFRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXLRGTSPQHSWMVAGPLFDIRAEAGSVAAVHLPHFVDLQGGHVDISLFQVAHFKEEG
MLLEKPARVEPHHTVLENPSFSPMGVLMRMVHAALSFIPITCTVLLYHRLHPGEVTFHLY
MIPSDCSIRKAIDDEEKKFQFVQIHKPPPLTSLYMGSCYTVSGPAKLEIIPKELELCYRS
LGEPQLFSEIYVDHLGSGIRLRLRDKKDRTVVWKALVKPGDLRPAAILDPPAPVASPSSP
DTPALLHFVDWYREQLVARVTSVDPVLDKLYGQVLSEEQYEQVRAEATRPCQMRKLFSFS
QSWDQACKDQLYQALKETHPHLIMELWEKGDGIGGLPSLRS
Download sequence
Identical sequences ENSMICP00000004633 ENSMICP00000004633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]