SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005287 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005287
Domain Number 1 Region: 41-477
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.7e-69
Family Integrin alpha N-terminal domain 0.0000000176
Further Details:      
 
Domain Number 2 Region: 780-1010
Classification Level Classification E-value
Superfamily Integrin domains 9.42e-64
Family Integrin domains 0.00000529
Further Details:      
 
Domain Number 3 Region: 640-773
Classification Level Classification E-value
Superfamily Integrin domains 1.05e-27
Family Integrin domains 0.0000412
Further Details:      
 
Domain Number 4 Region: 584-639
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000115
Family Integrin domains 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005287   Gene: ENSMICG00000005791   Transcript: ENSMICT00000005795
Sequence length 1058
Comment pep:novel genescaffold:micMur1:GeneScaffold_450:196809:364252:-1 gene:ENSMICG00000005791 transcript:ENSMICT00000005795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGARRPRGSRAQPLAPLWCVSAALGMMLWSPASQAFNLVKLTVYSVPEGSYFGYAVFH
IPDARTASVLVGAPKANTSQPDILEGGAVYYCPWPAEGSAQCKQIPFDTTXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXKGKVVACAPLYHWRTLRPTRAKDPVGTCYVAIQNFSAYAEY
SPCRNSNADPEGQGYCQAGFSLEFYKNGDLIVGGPGSFYWQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXYSVAAGEFTGDFQQXXXXXXXXXXXXXXXVSIINST
DMTFIQNFTGEQMASYFGYTVVVSDVNNDGMDDILVGAPLFMEREFESNPREVGQIYLYL
QVSSLFFRDPQVLTGTETFGRFGSAVAHLGDLNQDGYNDIAIGVPFAGKDKRGKVLIYNG
NKDGLNTKPSQILQGVWASQAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAVYXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDETEFRDKLSPINISL
NYSLNESTFKEGLEVKPILNYYRENAVSEQAHILVDCGEDNLCVPDLKLSARPXXXQVII
GDEHLMLIINARNEGEGAYEAELLAMIPEEADYVGIERNHKELRPLSCEYKMENVTRMVV
CDLGNPMVAGTNYSLGLRFAVPRLEKXXXXXXXXXXXXXSNKNNPDSNFVSLQINVTAIA
QVEIRGVSHPPQIVLPIHNWEPEDEPRREEEVGPLVEHIYELHNIGPSAISDTILEVGWP
FAARGEFLLYIFHILTLGPLQCQTNPDVNPQDIKPAASPEDTPELSAFLRNSTIPHLVRK
RDAPMFEFHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAQTFLKRKNDP
YALVSLVSFEVKKMPYKDQPAKLPEESIAIKTSVIWATPNVSFSIPLWVIILAILLGLLV
LALLTLALWKCGFFDRARPPQDETTDREQLTSTKTPDA
Download sequence
Identical sequences ENSMICP00000005287 ENSMICP00000005287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]