SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006158 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006158
Domain Number 1 Region: 2064-2125
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000561
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 2 Region: 473-599,641-715
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000042
Family Extended AAA-ATPase domain 0.037
Further Details:      
 
Domain Number 3 Region: 831-1055
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000186
Family Extended AAA-ATPase domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006158   Gene: ENSMICG00000006736   Transcript: ENSMICT00000006753
Sequence length 3272
Comment pep:novel genescaffold:micMur1:GeneScaffold_3919:33025:95019:1 gene:ENSMICG00000006736 transcript:ENSMICT00000006753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVCDCDREHCYLPSAFSQHKVLVTPQAPLEAIQDYLARHYRVPEQSQSAAAAFQDRMCVG
IVASERAGVGKSLYVKRLHDRLKLMLKSREVPLKTIRLIDPQVDEGRVLGSLLPFLAARY
QDRPVIFHVDVTSSVRTGVSVFLFKLLVLQYLMDIHGKMWLRKPCHLYVIEILEGNSVLP
RRSSRPGAHAPQFGFLDIFPKVTCRPPKEVQDMELSPERSDREPGMDLVEFCSETFQRPY
QYLRRFHRNENLDRFQYQEGSIEGNPQECLQHFLIYCGVINPSWLELGNFSRFLNYQLRD
CEASVFCDPDIIGDTLSGFKNFVVTFMIFMARDFSTPTLDTSDQSPGSNTVPMDGVKEED
LAPFSLRKRWESEPHPYVFFNADHTSMTFIGFHLQPNQNGGVDAVNRLTGTVIKRDVMTA
ELYRGLLLQRVPFNVDFDKLPRHEKLEKLCLVLGIQWPIDPDETYELTTDNMLKILAVEM
RFRCGIPVIIMGETGCGKTRLIKFLSDLRGGGADAQTIKLVKVHGGTTADMIYSKVREAQ
DIAVLNTANHQLDTILFLDEANTTEAVSAIKEVLCDRTVDGQPLAERSGLHVIAACNPYR
KHSEEAICRLESAGLGYRVRAEETADRLGSIPLRQLVYRVHALPPSLIPLVWDFGQLDDN
AEKLYIQQIVQRLVDSIRLEPAETRVITEVLSASQGFMRKRQDECSFVSLRDVERCVKVF
KWFYDHSEMLLVKLDSLVRESNTSKGHVQRDPILWSLVLAIGVCYHASLENKDSYRKDIC
RFFPEPYDDSKVILEEITRTQDLFLNGVPLRRTIAKNLALKENVFMMVICIELKIPLFLV
GKPGSSKSLAKTIVADAMQGQAAHSDLFRSLKQVHLVSFQCSPHSTPQGIIGTFRQCARF
QQGKDLRQYVSVVVLDEVGLAEDSPKMPLKALHPLLEDGCVEDDPAPHKKVGFVGISNWA
LDPAKMNRGIFVSRGSPSEQELTESARGICSSDSLVQDRIQGFFAPFARAYETVCESQDK
EFFGLRDYYSLIKMVFAVAKASNRKPSPQDIAQAVLRNFSGKDDIHALDIFTASLPEAKC
SEEVSTVQLIKQNIYGALEKVPGRGLDDVDSRYLLLLTKNYVALQILQQTFFSEGQQPEI
IFGSSFPKDQEYTQICRNINRVKVCMETGKMVVLLNLQNLYESLYDALNQYYVYLGGQKY
VDLGLGTHRVKCRVHPDFRLIVIEEKEVVYTRFPIPLINRLEKHYLDLSTVLEKWQKSIV
DELETWVAKFVHVKVDPFQGRHKYSPSDVFIGYHSDTCASVVLQVTERQGPRGPTEELYQ
KVSTEAKLTLLDCATPDAVVRLSASSLGFFAAVSLSREYYHTQQHDSFADFLWAHLEATS
QESHAVFTEVTTFSRLLTSHDCEALASELAGRAAKPTVLWLQHFYTEQSFLKAVRNGLTC
AAGCKILIIQTDFEDGVHSAQLIASAKYSAVNEINNIQGNEGCVLVYFITKLSRMGSGAS
YVGFHGGLWRSVHIDDLRRSTVMVSDVTRLQSVTVSQLFEPGEQPELAMGHGAEDDGEEA
METESSRSGETADGEMETESSRGTEDETSQTGGRDVLDTTRLLRSCVQSAVGVLRDQSES
CGRNMRRVELLLSLLSEDSERSASFLRVSKMRLHDLLKKQEESHLPSLKQWVSREASNQD
ALQEAGTFRQTLWKRVQRAVTPLLARVISFIDRDGNLELLARPDSPPWARDLWMFIFSDT
KLLNIPLVMNNARAESEMPSIVVQNYMNLPENASSDVPFSWRIKDYLEELWAQAQYITDA
EGLSQKLVEIFRQTPLGVFLAQLREEQQQELLQHYCSDFLLLTTRVSSPEELKLLEVALW
SGISELRAASGRPEQGVSLPWVHLAYLHFRSRLQNLSRILTIHPQVLCSLAQASQNRQLA
GPEMTLDVTAATACVEMLTRDALRPSPQAWVQLVKNLSTPLELVCADGHVRGSTRLTAAV
GEVRHQWNRILSTALFVEHVLLGTESQVPELSKLVTDHVFLLDKCLQENSDIKTHRPFVA
VMKVLCECKDRASRTLTRGGIQPCPICLGDAQDPVCLPCDHVYCLHCIETWMVPAQMMCP
YCLTALPGTFSPTVSHVHRRAIEKHAQFRQMCNSFFVDLVSTVCFKDNTPPQKEVIDSLL
SLLFVHKELLKDTPQGHREHTKSLSPFNDVVDKTPVIRSVVLKLLLKYSFHDVKDYIQDY
LSLLKTKALITEDKTELYMLXXXXXXDSVHEKTSACSRKDELKNLQEQRHFLETYPQASR
GQEAAREASVEYLQEIATVRLCLDRASDFLAELQGGSETAEEKRSYLRQVERFCTRVEND
WYRVYLVRKLASQWGMEFVQGLSKPGHPCQWVFPKGVIEQQVLQKDHPGRIDRYLVYGDE
YKALRDATAKAVLKCKPLSIVTAMKACRKTKTQQAVHLLLALFKEVAVLYRSSNTNLHPK
REQREAVNKFIEECEVFSPAVRCFATSLVENTLPLLRKSPGDNGLEGTVTEMAIHAAAIL
LCGQNRVLEPLKNLAFSPATMVNAFLPTMPEDLLAQARTWKGLEGVRWYTCPNGHPCSVG
ECGMPMEQSLCVDCGAPIGGSNHRPHDGFSVIQHSTDRTQTGHVLGDACRRGVAVAPDRE
LSPAVFLLTRLLTHLAMLLGAVQDPQALMNIIKPRVRDPSGFLRQHVQADLQQLTRMLGR
SADETTNAVHLVLRSLVQEQHLPCGQRLLNFDAKLSTKEMRNNWEKQVEAIMLPELQXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXDPMTFLPHLPRKSEVHCSKIWSCRKRITVEYLQ
HIVEQKNGKETVPVLWQFLQKEAELGLVKFLPEILALQRSLVKRFQNVPQVEYNSIRSFI
SSQNSDGLRQLFQERITLFLSTWNKLRRSLETNGEIKLPADYCSVDLDLDAEFEVILPRR
RGLGLCSTALVSYLINLHNQIVYTVEKFSNESNSYSVDASEVTDLHVINYEAERDLTPLI
LSNCQYQVEQGGETSQEFHLEKIQRQVTSRCLQGKPRLTLKGIPTLVYRHDWNYEHLFVD
IKNRMAQNSLPKSAIRAISGQLQSYSDTCEALSIIEVTLGFLSTAGGDPNMCLNTYVQDV
LRMGDQTALVLKALERCQLKHSIALWQLLSAYKSEQLLRLNKEPFREISSRYKEDLSPEN
AKLLGTFLNQISLDTFLLELHEMMVLKLKNRQDQDSFNPEWILRDTLVVCMETKESEILP
EVEYQFPGEILLSNCVCVWKMAAALKRDRQMR
Download sequence
Identical sequences ENSMICP00000006158 ENSMICP00000006158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]