SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006375 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006375
Domain Number 1 Region: 1387-1644
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-57
Family YWTD domain 0.00000311
Further Details:      
 
Domain Number 2 Region: 782-1032
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-52
Family YWTD domain 0.00000215
Further Details:      
 
Domain Number 3 Region: 1083-1336
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-48
Family YWTD domain 0.0000031
Further Details:      
 
Domain Number 4 Region: 480-647,679-736
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-42
Family YWTD domain 0.00000828
Further Details:      
 
Domain Number 5 Region: 303-343
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000511
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 6 Region: 266-305
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000111
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 7 Region: 397-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000327
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 183-223
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 9 Region: 108-146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 10 Region: 348-384
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 11 Region: 1341-1386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000145
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 12 Region: 148-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 13 Region: 738-775,1027-1078
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000612
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 14 Region: 427-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 15 Region: 66-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000006375
Domain Number - Region: 1644-1682
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000289
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006375   Gene: ENSMICG00000006982   Transcript: ENSMICT00000007000
Sequence length 1935
Comment pep:novel genescaffold:micMur1:GeneScaffold_2842:680896:727586:-1 gene:ENSMICG00000006982 transcript:ENSMICT00000007000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLWGALLLGALLCAHAVALRLRARGEGTRNSPQLSGLRRGSGGGAHPGSGLGRSGSLA
SSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCMLPTCSPLDFHCDN
GKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNGYCIRSLWHCDGDNDCGDNSD
EQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEESCPSAVPAPPCNLEEQCAYG
RCIXXXXXXXXXXXXXXXXXXXXXXSHQPCRSGEFMCDSGLCINAGWRCDGDADCDDQSD
ERNCTTSMCTAEQFRCRSGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCASDQFLCWN
GRCIGQRKLCNGVNDCGDNSDESPQQNCRPRTGEENCNVNNGGCAQKCQMVRGAVQCTCH
TGYRLTEDGRTCQDVNECAEEGYCSQGCTNSEGTFQCWCETGYELRPDRRSCKALGPEPV
LLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVTLDRILRANLNGSN
VEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLWQNLEKPRAIAL
HPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKL
HFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGFRKINSHACAQSLD
KFLLFARRMDIRRISFDTEDLSDDVIPLADVRSAVALDWDSRDDHVYWTDVSTDTISRAK
WDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMRTVLIWENLDRP
RDIVVEPMGGYMYWTDWGASPKIERAGMDASERQVIISSNLTWPNGLAIDYGSQRLYWAD
AGMKTIEFAGLVLIGSQLPHPFGLTLYGERIYWTDWQTKSIQSADRLTGLDRETLQENLE
NLMDIHVFHRRRPPVSTPCVVENGGCSHLCLRSPNPSGFSCTCPTGINLLPDGKTCSPGM
NSFLIFARRIDVRMVSLDIPYFADVVVPINITMKNTIAIGVDPQEGKVYWSDSTLHRISR
ANLDGSQHEDIITTGLQTTDGLAVDAIGRKVYWTDTGTNRIEVGNLDGSMRKVLVWQNLD
SPRAIVLYHEMGFMYWTDWGENAKLERSGMDGSERTVLINNNLGWPNGLTVDKASSQLLW
ADAHTERIEAADLNGANRHTLVSPVQHPYGLTLLDSYIYWTDWQTRSIHRADKGTGSNVI
LVRSNLPGLMDIQAVDRSQPGFNKCGSRNGGCSHLCLPRPSGFSCACPTGIQLKGDGKTC
DPSPETYLLFSSRGSIRRISLDTSDHTDVHVPVPELNNVISLDYDSVDGKVYYTDVFLDV
IRRADLNGSNMETVIGRGLKTTDGLAVDWVARNLYWTDTGRNTIEASRLDGSCRKVLINN
SLDEPRAIAVFPRKGYLFWTDWGHIAKIERANLDGSERKVLINTDLGWPNGLTLDYDTRR
IYWVDAHLDRIESADLNGKLRQVLVSHVSHPFALTQQDRWIYWTDWQTKSIQRVDKYSGR
NKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCFARALDFVCACPDEPDGRPC
FLVPGLVPPDPRATSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCSERDARLGLCA
HSNEAVPAAPGEGLHISYAIGGLLSILLILVVIAALMLYRHKKSKFTDPGMGNLTYSNPS
YRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDHNYTKEKIIVEGICLLSGDDAEWDDLKQL
RSSRGGLLDHVCMKTDTVSIQDSSGSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXHERKLSSESQV
Download sequence
Identical sequences ENSMICP00000006375 ENSMICP00000006375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]