SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006558 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006558
Domain Number 1 Region: 302-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 70-131
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 358-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.94e-22
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.92e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 264-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-19
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 6 Region: 456-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.6e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000006558
Domain Number - Region: 3-40
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0124
Family SCAN domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006558   Gene: ENSMICG00000007201   Transcript: ENSMICT00000007198
Sequence length 521
Comment pep:novel genescaffold:micMur1:GeneScaffold_4259:23745:38246:1 gene:ENSMICG00000007201 transcript:ENSMICT00000007198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMPQQLLITLPTKASTWVKLHHPKRTKEGAPRWEDVTKMFEGEVLLSRDANVTQGESLED
EVTSGPPAAESQELLTFKDVSIDFTQEEWGQLGPVHQNLYREVMLENYRNLVSVGYQLSK
PSVISQLEKGEEPWMTEKEGPGDPSSELKRKTETGAKKPTSQLELYHGIMMERVMKDDII
YSTLRKVSKYDDVLERHQETCVRDVRQTILTYKERGQETNKFGENIIVSSNLIIEQRHHK
CDTPRKNKYKLDLINHPTNYIRTKTYECNICEKIFKQPIHLTEHMRIHTGEKPFRCKECG
RAFSQSASLSTHQRIHTGEKPFECEECGKTFRHRSSLNQHHRTHTGEKPYVCDKCQKAFS
QNISLIQHLRTHSGEKPFTCNECGKTFRQIRHLSEHIRIHTGEKPYACTACCKTFSHRAY
LTHHQRIHTGERPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECNRCGKAYRHDSSFKKH
QRHHTGEKPYECNECGKAFSYNSSLSRHHEIHRRNAFRNNV
Download sequence
Identical sequences ENSMICP00000006558 ENSMICP00000006558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]