SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006704 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006704
Domain Number 1 Region: 18-213
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.17e-51
Family Ephrin receptor ligand binding domain 0.00000727
Further Details:      
 
Domain Number 2 Region: 721-899
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.95e-43
Family Protein kinases, catalytic subunit 0.000000877
Further Details:      
 
Domain Number 3 Region: 346-558
Classification Level Classification E-value
Superfamily Fibronectin type III 2.52e-32
Family Fibronectin type III 0.0000564
Further Details:      
 
Domain Number 4 Region: 924-996
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.44e-17
Family SAM (sterile alpha motif) domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000006704
Domain Number - Region: 284-334
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0259
Family TNF receptor-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006704   Gene: ENSMICG00000007364   Transcript: ENSMICT00000007369
Sequence length 998
Comment pep:novel genescaffold:micMur1:GeneScaffold_4669:105270:113162:1 gene:ENSMICG00000007364 transcript:ENSMICT00000007369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCSLGVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEAC
HVAGAPPGTGQDNXXXXHFVERRGAQRVHIRLHFSVRACSSLGVSGGTCRETFTLYYRQA
EEPDSPGSVPAWHLKRWNKVDTIAADESFPPSSSSSSSSSSLAWAVGPHGAGQRAGLQLN
VKERSFGPLTQRGFYVAFQDTGACLALVAVRLFSYTCPAVLRAFASFPETQASGAGGASL
VAAVGTCVANAEPEEDGVGGQAGGSPPRLHCNGEGKWMVAVGGCRCQPGHQPARGDKACQ
ACPRGLYKAQAGDAPCSPCPARSHAATTAAPVPCGFYGSRPPEPCTPPSAPRELWFEVQG
SALMLHWRLPQELGGRGDLLFNVVCKECAGQQEPGGSGSTCRRCRDEVHFDPRQRGLTES
RVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEVPSAVPVVHQVSRAANS
ITVSWPQPDQANGNILDYQLRYYDQAEDESHSFTLTSETNTATVTQLSPGHIYGFQVRAR
TAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSILGALAFLLLAAITVLAVVFQRKR
RGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIRELAREVDPAYIKIEEVIGTXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXP
LMVLTELMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLSSFAFVHRALSAHSVLV
NSHLVCKVARLGHSPQGPGCLLRWAAPEVIAHGKHTTASDVWSFGIVMWEVMSYGERPYW
DMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPHFDQLVAAFDKMIRKPD
TLQAGGDLGDRPSQALLNPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDVAQL
SLEDLPALGVTLAGHQKKLLHNIQLLQQHLRQPGSVEV
Download sequence
Identical sequences ENSMICP00000006704 ENSMICP00000006704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]