SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006741 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006741
Domain Number 1 Region: 152-214
Classification Level Classification E-value
Superfamily SH3-domain 7.48e-24
Family SH3-domain 0.000021
Further Details:      
 
Domain Number 2 Region: 101-157
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000427
Family SH2 domain 0.0000348
Further Details:      
 
Domain Number 3 Region: 3-26
Classification Level Classification E-value
Superfamily SH3-domain 0.00000223
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006741   Gene: ENSMICG00000007414   Transcript: ENSMICT00000007409
Sequence length 217
Comment pep:novel genescaffold:micMur1:GeneScaffold_1603:56225:123657:-1 gene:ENSMICG00000007414 transcript:ENSMICT00000007409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAIAKYDFKATADDELSFKRGDILKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRG
DFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
Download sequence
Identical sequences ENSMICP00000006741 ENSMICP00000006741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]