SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007559 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007559
Domain Number 1 Region: 53-239
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.71e-76
Family T-box 0.000000361
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007559   Gene: ENSMICG00000008299   Transcript: ENSMICT00000008298
Sequence length 517
Comment pep:novel scaffold:micMur1:scaffold_2431:76343:121301:-1 gene:ENSMICG00000008299 transcript:ENSMICT00000008298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADADEGFGLAHTPLEPDSKDLPCDSKPESTLGAPSKSPSSPQAAFTQQGMEGIKVFLHE
RELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNK
WSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQLKLTNNHLDFGHIILNSMHKYQPR
LHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGSDDM
ELHRMSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSASSNLGSQYQCENGVSGPSQ
DLLPPPNPYPLPQEHGQIYHCTKRKDEECSTTDHPYKKPYMETSPSEEDSFYRSTYPQQQ
GLSASYRTESAQRQACMYASSAPPSEPPVPSLEDISCNTWPSMPSYSNCTVTTVQPMDRL
PYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTPVAHQPVVRQCGPQTGLQSPGT
LQPPEFLYSHSVPRTLSPHQYHSVHGVGMVPEWSENS
Download sequence
Identical sequences ENSMICP00000007559 ENSMICP00000007559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]