SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008076 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008076
Domain Number 1 Region: 18-196
Classification Level Classification E-value
Superfamily p53-like transcription factors 9.94e-74
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000127
Further Details:      
 
Domain Number 2 Region: 191-323
Classification Level Classification E-value
Superfamily E set domains 3.97e-51
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008076   Gene: ENSMICG00000008872   Transcript: ENSMICT00000008871
Sequence length 551
Comment pep:novel genescaffold:micMur1:GeneScaffold_105:447505:456260:-1 gene:ENSMICG00000008872 transcript:ENSMICT00000008871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDLFPLIFPSEPAQVSGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDSSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSTTSIPKPAPQPYPFTSSLSTINF
DEFSPMVFPSGQIPSQASALAPAPTQVLSHTPAPTSAMASALAQAPAPVQVLAPGPLQAV
APPAPKPTQAGEGTLTEALLQLQFDADEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GVSMAPHTAEPMLMEYPESITRLVTGSQRPPDPAPNPLGASGIPNGLLSGDEDFSSIVDM
DFSALLSQISS
Download sequence
Identical sequences ENSMICP00000008076 ENSMICP00000008076 XP_012633553.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]