SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008242 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008242
Domain Number 1 Region: 840-924
Classification Level Classification E-value
Superfamily DEATH domain 5.89e-24
Family DEATH domain, DD 0.0000456
Further Details:      
 
Domain Number 2 Region: 168-259
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000234
Family I set domains 0.02
Further Details:      
 
Domain Number 3 Region: 258-309
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000327
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 312-366
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.00076
Further Details:      
 
Domain Number 5 Region: 62-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000172
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008242   Gene: ENSMICG00000009052   Transcript: ENSMICT00000009050
Sequence length 930
Comment pep:novel genescaffold:micMur1:GeneScaffold_2137:255081:502386:-1 gene:ENSMICG00000009052 transcript:ENSMICT00000009050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKGLRATAARCGLGLGYALQMLVLPALALLSASGTGSAAQDDDFFHELPETFPSDPPEP
LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVR
EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSL
EQEVLLQCRPPEGPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVA
KNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGFQKRTRTCTNPAPLNGGAFCEG
QSVQKIACTTLCPVDGRWTSWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSKN
CTDGLCMQTAPDSDDVALYVGIVIAVMVCLAITVIVALFVYRKNHRDFESDIIDSSALNG
GFQPVNIKAARQDLLAVPPDLTTAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIKV
YNTSGAVTPQDDLSELTSKLSPQMTQSLLENEALNLKNHSLARQTDPSCTAFGSFNSLGG
HLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMEECQTLLTPVVSCGPPGALL
TRPVIVTMRHCADPNTEDWKIQLKTQGAQGQWEDVVVVGEENFTTPCYVQLDAEACHILT
ESLSTYTLVGQATTKAAAKRLKLAIFGPLCCSSLEYSVRVYCLDDTQDALKEVVHLERQM
GGQLLEEPKALHFKGSTHNLRLSIHDVAHSLWKSKLLAKYQEIPFYQIWSGSQRNLHCTF
TLERFSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGVDLPLLDPASTITTVTGPSA
FSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNF
PDGNLSMLATVLEEMGRHETVVSLAAEGQY
Download sequence
Identical sequences ENSMICP00000008242 ENSMICP00000008242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]