SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008794 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008794
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.0000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008794   Gene: ENSMICG00000009667   Transcript: ENSMICT00000009663
Sequence length 195
Comment pep:novel genescaffold:micMur1:GeneScaffold_1926:103217:126345:-1 gene:ENSMICG00000009667 transcript:ENSMICT00000009663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITCPTPTSVEHAGIRVKSYSVHSRERYVCNSGFKRKAGTSSLTQCMFNETTQTAHWTAPN
LKCIRDPSLTHQRPVPFSTATTARVTLQPESPSPSGKAAASSPGADTTVAAETAVAPHSP
SKPPSAGPPGPGGQESSQAPSQTTAAGTSEGTPSAPRQPPGANPFSSRNATVTISTSAVL
LCVLGTALLACCMKS
Download sequence
Identical sequences ENSMICP00000008794 ENSMICP00000008794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]