SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008885 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008885
Domain Number 1 Region: 16-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.6e-65
Family BAR domain 0.00000000872
Further Details:      
 
Domain Number 2 Region: 284-347
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-23
Family SH3-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008885   Gene: ENSMICG00000009761   Transcript: ENSMICT00000009757
Sequence length 352
Comment pep:novel genescaffold:micMur1:GeneScaffold_192:390232:483109:1 gene:ENSMICG00000009761 transcript:ENSMICT00000009757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGXXXXXXXXXXKVSEKVGGAEGTKLDDDFKEMERXXXXXXXXXXXXXXXXXXXXXX
XXXSRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGDVGEA
MRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL
EERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGAPMDQPCCRALYD
FEPENEGELGFKEGDIITLTNQIDENWYEGMLRGQSGFFPINYVEILVALPH
Download sequence
Identical sequences ENSMICP00000008885 ENSMICP00000008885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]