SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009439 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009439
Domain Number 1 Region: 853-1063
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-63
Family Protein kinases, catalytic subunit 0.0000203
Further Details:      
 
Domain Number 2 Region: 560-700
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.24e-18
Family Protein kinases, catalytic subunit 0.0019
Further Details:      
 
Domain Number 3 Region: 141-265
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000502
Family Second domain of FERM 0.009
Further Details:      
 
Domain Number 4 Region: 770-839
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000211
Family Protein kinases, catalytic subunit 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009439   Gene: ENSMICG00000010345   Transcript: ENSMICT00000010365
Sequence length 1073
Comment pep:novel genescaffold:micMur1:GeneScaffold_1768:170066:187010:-1 gene:ENSMICG00000010345 transcript:ENSMICT00000010365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLCQRRGSRRGEPNADEAQPLAAVGGLKVLLHWAGPGGEPWVTFSEGSLTAEEVCIRIA
HKIGITPPCVNLFALFDAQAQVWLPPNHLLEISGDTSLLLYFRMRFYFRNWHGMNPQEPA
VYRCGPPSTEASSEQTEQGVQLLDPASFAYLFEQGKHEFVNDVASLWELSNEEEIHHFKN
ESLGMAFLHLCQLALHRGVPLQEVAKNISFKDCIPRSFRRQIRQHNVLTRLRLRSVFRKF
IRAFQPGLLSQQVVMVKYLATLERLAPRFGTERLPVCHLRLLAQAEVEPCYTLDSGQSPA
DPSPESAAGPSTHEVLVAGTGGIQWRPIQTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEPFVQAKLRPEDGLYLIHWSTGHLYRLILT
VAXXCKESSSMQLNQPAEFPTHRQDEINQRGGREGRVPGGAGSQEGAGSRRGRGPGRRGR
GPRRPGSRRGRGPEGPGSQLSHLGQGTRTNVYEGVLQVEGADPEEGKVDGGDPLVPGGNC
GQKLRVVLKVLDPSHHDIALAFYETASLMSQVSHVHLAFVHGVCVRGSENIMVTEYVEHG
PLDVWLRRERGHVPVAWKVLVTQQLASALSYLEDKNLVHGXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATLLEICFDGEA
PLQGRGPSEKERFYQKQHQLPEPSCPELATLTRQCLTYEPGQRPSFRTILRDLTRLQPHN
LADVVTVNPDSPASDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALK
ADCGPQLRSGWRREIDILRTLYHDHIVRYKGCCEDQGEKSVQLVMEYVPLGSLRDYLPRH
SVGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHE
YYCVREDGDSPVFWYAPECLKEGKFYYASDVWSFGVTLYELLTYCDSSQSPPS
Download sequence
Identical sequences ENSMICP00000009439 ENSMICP00000009439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]