SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010314 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010314
Domain Number 1 Region: 628-890
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-77
Family Protein kinases, catalytic subunit 0.000000000652
Further Details:      
 
Domain Number 2 Region: 39-210
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.78e-73
Family Ephrin receptor ligand binding domain 0.000000218
Further Details:      
 
Domain Number 3 Region: 339-545
Classification Level Classification E-value
Superfamily Fibronectin type III 7.43e-39
Family Fibronectin type III 0.0000864
Further Details:      
 
Domain Number 4 Region: 922-995
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.35e-21
Family SAM (sterile alpha motif) domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000010314
Domain Number - Region: 266-336,376-396
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000131
Family Growth factor receptor domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010314   Gene: ENSMICG00000011330   Transcript: ENSMICT00000011327
Sequence length 998
Comment pep:novel genescaffold:micMur1:GeneScaffold_456:1394459:1413596:1 gene:ENSMICG00000011330 transcript:ENSMICT00000011327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARARPLSPPPPPPPGLLPLLPPLLLLPLLLPAGCRALEETLMDTRWVTSELAWTAHPES
GWEEVSGYDEAMNPIRTYQVCNVQESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIP
NIPGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDTIAPDESFSRLDTGRVNTKVRS
FGPLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAEPTSLVIAPGT
CISNAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGP
CLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPGVISNVNETSLILEWSE
PRDLGGRDDLLYNVICKKCRGGPGAGGPSTCSRCDDNVEFVPRQLGLTERRVYISHLLAH
TRYTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLHLHSSSGSSLTLSWAPPER
PNGVILDYEMKYFEKSEGIASTVTSQKNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPA
EFETTSERGSGAQQLQEQLPLIVGSATAGLVFLAAIVVIAIVCLRKQRHSSDSEYTEKLQ
QYIAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRR
EVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCA
LDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFG
LSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERP
YWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKSQIVNXXXXXXXXA
ALKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQM
TAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV
Download sequence
Identical sequences ENSMICP00000010314 ENSMICP00000010314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]