SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011800 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011800
Domain Number 1 Region: 536-563,605-686
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000412
Family Anti-sigma factor antagonist SpoIIaa 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011800   Gene: ENSMICG00000012956   Transcript: ENSMICT00000012949
Sequence length 702
Comment pep:novel genescaffold:micMur1:GeneScaffold_3852:153601:156562:-1 gene:ENSMICG00000012956 transcript:ENSMICT00000012949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSESLRHGRWLMLLRPQTIASLDQSKILKASLLSCSCGLRARAMLQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAGLQPIYSLYTSVFANLIYFFMSTSRHISV
GIFSLLCLMVEQVVDRELHLAGFDPSQDSLGPRANGSNLNDSAATLVLGPPDCGRDCYAI
RVATALTLVAGVYQVLMGVLQLGFVSAYLSQPLLDGFAMGASVTILTSQLRHLLGVRMPR
HQGLGMVVSTWLSLLRSASQANVCDVVTSTICLAVLLVAKELSDRCRHRLRVPLPTELLV
IVVATLVSHFGQLHERFGSSVAGNIPTGFVAPRVPDPELMQRVALDAVALALVGSAFSIS
LAEMFAHNHGYSIRANQELLAVGCCNVLPAFFHCFATSAALAKSLVKTSTGCRTQLSSVV
SAAVVLLVLLVLAPLFRDLQRSVLACVIVVSLRGALRKVRDLPRLWRLSPADALVWMGTA
ATCVLVSTEAGLLAGVILSLLSLVGRTQRPHAALLARIGDSAFYEDTTEFEGLVPEPRVQ
VFRFSGPLYYANKDFFLQSLYSLTGLDAGRLAARRKERSSEVGASETDPVESKDGPGNSR
AALVPTAAGFHTVVIDCAPLLFLDTTGMATLQGLRQDYKALGISLLLACCSPPVRDALGK
GGFLREDQGDVAEEEQLFHSVHSAVLAARARHGELAAADSTL
Download sequence
Identical sequences ENSMICP00000011800 ENSMICP00000011800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]