SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012285 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012285
Domain Number 1 Region: 145-284
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.94e-42
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000197
Further Details:      
 
Domain Number 2 Region: 620-797
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.92e-32
Family AlaX-like 0.026
Further Details:      
 
Domain Number 3 Region: 340-487
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 9.42e-27
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00056
Further Details:      
 
Domain Number 4 Region: 545-620
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000812
Family AlaX-M N-terminal domain-like 0.0072
Further Details:      
 
Domain Number 5 Region: 39-81
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.000000194
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012285   Gene: ENSMICG00000013453   Transcript: ENSMICT00000013470
Sequence length 984
Comment pep:novel genescaffold:micMur1:GeneScaffold_1208:85533:98069:-1 gene:ENSMICG00000013453 transcript:ENSMICT00000013470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVAAAAGRLRRAIRRSPPWLGPSRRPISSEPPPAQASAVRDAFLSFFRDRHGHRLVP
SASVRPRGDPSLLFVNAGMNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXEEACSMAWELLTRVYGIPENRLWVSYFGGDPKAGL
HPDLESRDIWLSLGVPASRVLSFGPQENFWEMGDTGPCGPCTEIHYDLAGGVGAPQLVEL
WNLVFMQYNREANGSLQPLPQRHVDTGMGLERLVAVLQGKPSTYDTDLFSPLLNAIHQXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGMSGAPLVLRRILRRAVRF
SAEVLQAPPGFLGSLVPVVVQTLGEAYPELQKNSAQIASLVSEDEAAFLASLQRGRRIID
RTVRRLGPSDVFPAEVAWSLSLSGNLGLPLDLVELMLEEKGVQLDTAGLQRLAQEEAQHR
AQQAEPVQEQGLRLDVHALGDLQRRGVPPTDDSPKYNYCLGPNGDYEFGTCEAQVLQLYT
EDGTAVASVGEGQHCGLLLDRTNFYAEQGGQASDRGYLVRAGQQDVLFPVARAQVCGGFI
LHEVVAPECLQVGDQVQLHVDKAWRLGCMKKHTATHLLNWALRQALGPGTEQRGSHLNPE
RLRFDVATQAPLTPEQLRAVERTVQEAVGLDQAVYVEEVALALTAHVPGLRSLDEVYPDP
VRVVSVGVPVTCALDPASQAALQTSVELCCGTHLLRTGAVGDLVITGERQLSKGTTRLLA
VTGEQAQQAREVGQSLAQEVEAAAERLSRGSQDVAEAQQLSKDMGRLIDAVDTTTMPQWQ
RRELQATLKALQRRANTARKLEMGQAAKKTQELLGRHSKGPLIVDTVSAESLSVLVKVVR
QLCEQAPSTSVLLLSPQPVGSVLCACQVAQGATPSFTAEAWALAVCKHMGGKAWGSRVVA
QGTGSAADLDAALSTARAYALSQL
Download sequence
Identical sequences ENSMICP00000012285 ENSMICP00000012285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]