SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013047 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013047
Domain Number 1 Region: 612-894
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.01e-81
Family Protein kinases, catalytic subunit 0.000000000801
Further Details:      
 
Domain Number 2 Region: 30-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.04e-46
Family Ephrin receptor ligand binding domain 0.0000105
Further Details:      
 
Domain Number 3 Region: 327-531
Classification Level Classification E-value
Superfamily Fibronectin type III 4.55e-40
Family Fibronectin type III 0.00013
Further Details:      
 
Domain Number 4 Region: 906-977
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.91e-21
Family SAM (sterile alpha motif) domain 0.0000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013047   Gene: ENSMICG00000014302   Transcript: ENSMICT00000014312
Sequence length 982
Comment pep:novel scaffold:micMur1:scaffold_109:540182:673007:-1 gene:ENSMICG00000014302 transcript:ENSMICT00000014312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIFYFVLFSFLFGICEVVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIM
DEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGAMQTCKE
TCSSYYYESDNDKECFIRESIAKIETIAACESFTLADIGDRIMKLNAENRDGGPXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCKIGYYKALSTDATCAKCPPHSYSVW
EGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDIS
YNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTRVSITDLLAHTNYTFEIWAVNGVSK
YNPSPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYEK
DQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRIIG
DGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFT
YEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTD
KQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVI
QLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYTT
RGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGY
RLPPPMDCPIALHQLMLDCWQKERNDKPKFGQIVNMDKFIDSNSKRTGPEISRPNTALLD
PSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHMNQDDLARIGITALTHQNK
ILTSIQAMRTQMQQVHGRMVPV
Download sequence
Identical sequences ENSMICP00000013047 ENSMICP00000013047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]