SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013147 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013147
Domain Number 1 Region: 343-470
Classification Level Classification E-value
Superfamily Second domain of FERM 5.89e-32
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 472-576
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-24
Family Third domain of FERM 0.0051
Further Details:      
 
Domain Number 3 Region: 95-207
Classification Level Classification E-value
Superfamily PDZ domain-like 2.43e-16
Family PDZ domain 0.012
Further Details:      
 
Domain Number 4 Region: 254-337
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000455
Family Ras-binding domain, RBD 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013147   Gene: ENSMICG00000014417   Transcript: ENSMICT00000014420
Sequence length 1362
Comment pep:novel genescaffold:micMur1:GeneScaffold_19:1012313:1544312:1 gene:ENSMICG00000014417 transcript:ENSMICT00000014420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPLPPGAGSPGPPPAVAATRAPGALRSQPWGCRCWREKGRRTCRARSPAACMDVFSFVKM
AKLSSHRTKSSGWPPPSGTWGLNQVPPYGWEMTANRDGRDYFISHMTQAIPFDDPRLESC
QIIPPAPRKVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGKLIPGDQIVMINDEPVS
AAPRERVIDLVRSCKESILLTVIQPYPSPKSAFISAAKKARLKSNPVKVRFSEEVIINGQ
VSETVKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQEKLSIKGIEHFSLML
EQRTEGAGTKLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPKDPIDLLRRDPVAFEYLY
VQSCNDVVQERFGPELKYDIALRLAALQMYIATVTTKQTQKISLKYIEKEWGLETFLPSA
VLQSMKEKNIKKALSHLVKANQNLVPPGKKLSALQAKVHYLKFLSDLRLYGGRVFKATLV
QAEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFPEEENLVRVELHVLDA
KPITLLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNTATQDTGLKNKGKHNLLGP
DWNCIPQMTTFIGEGEQEAQITYIDSKQKAVEMTDSAMCPKEHRHLFIDSTYNSDELSQP
LTQPGEAPCEADYRSLAQRSLLTLSGPETLKKAQESPRGAKVSFIFGDLALDDGISPPTL
GYETLLDESPEMLEKQRNLYIGSANDMKGLDLAPDAESIQFVANSVYANIGDVKSFQATE
GIEEPLLHDICYAENTDDAEDEDEVSCEEDLVVGEMNQPAILSLSGSSDDIIDLTSLPPP
EGDDNEDDFLLRSLNMAIAAPPPGFRDSSDEEDSQSQGASFREDKEQGSSLQNDDIPVSL
IDAVPTSAEGKCEKGLESAVVSTLEALEALSVSEEQQTSDNSGVAILRAYSPESSSDSGN
ETNSSEMTESSELATAQKQSENLSRMFLATHEGYHPLAEEQTEFPASKPPAGSLPPKSSH
ALAARPATDLPPKVVPSKQILHSDHMEMEPETMETKSVTDYFSKLHMGSVAYSCTSKRKS
KLADGDGKAPPNGNMPGNKQQGTKTAELEEDTGGKFGTVSSRDSQHLSTFNLERTAFRKD
SQRWYVATEGGVADKSGLEAATGKTFPRASGLGPREAEGKDEGAPDGEASDVSGLGQGDR
FLTDVTCASSAKDLGNPEDADSSGCDHPSKLPEAEESVARLCDYHLAKRMSSLQSEGHFS
LQSSQGSSVDAGCGTGSSGSACATPVESPLCPSMGKHLIPSEERAPGLPGHGATFKDLHP
QTEGMCPRMTVPALHSAINAEPLFGTLRDGCHRLPKIKETTG
Download sequence
Identical sequences ENSMICP00000013147 ENSMICP00000013147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]