SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013211 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013211
Domain Number 1 Region: 534-604
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.89e-17
Family SAM (sterile alpha motif) domain 0.00087
Further Details:      
 
Domain Number 2 Region: 1081-1150
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000511
Family SAM (sterile alpha motif) domain 0.0071
Further Details:      
 
Domain Number 3 Region: 453-553
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000328
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013211   Gene: ENSMICG00000014483   Transcript: ENSMICT00000014494
Sequence length 1158
Comment pep:novel scaffold:micMur1:scaffold_248:45072:140618:1 gene:ENSMICG00000014483 transcript:ENSMICT00000014494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKPDASPTSLQLRSQIEESLGFCSAVSTPEVERKNPLHKSNSEDGSVGKGDWKKKNKYFW
QNFRKNQKGIMRQTSKGEDVGYVASEITMSDEERIQLMMMVKEKMITIEEALARLKEYEA
QHRHSGALGPADWPDGPYPTCDGSSNCNSREQSDDETEESVKFKRLHKLVNSTRRVRKKL
IRVEEMKKPSNEGGEEHVFENPPVLDERSALYSGVHKKPFFFDGSPEKPPEDDSDSLTTS
PSSSSLDTWGAGRKLVKTFSKGESRGLIKPPKKMGTFFSYPEEEKAQKVSRSLTEGEMKK
GLGSLSHGRTCSFGGFDLTNRSLHIGSNSSDPMGKEGDFVYKEVIKSPTASRISLGKKVK
SVKETMRKRMSKKYSSSVSEQDSGLDGMPGSPPSSQPDSEHIDKPKLKAGGSVESLRSSL
SGQSSMSGQTVSTTDSSTSNRESVKSEDGDDEEPPYRGPFCGRARVHTDFTPSPYDTDSL
KLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLNEDEEKPKRPTRRRRKGRPPQP
KSVEDLLDRINLKEHMPTFLFNGYEDLDTFKLLEEEDLDELNIRDPEHRAVLLTAVELLQ
EYDSNSDQSGSQEKLLVDSQGLSGCSPRDSGCYESSENLENGKTRKTSLLSAKPSTESSL
KSFKRSQLGNYPTLPLTKSAGGVLKQGEEEGRLGGGLRPDPSKGCDPPGGTGLTKNRRSL
PVSICRSCETLEGAQTVEAWPRSHSLDDLQGEPGAEQDVPAEVAEPSPQIVPEVPRKTSA
SATKAQPRARDSAGDNALLLTQSKRFSEPQKTTTKKPEGSAAASPRGSAPPPCLPRNYDA
QPPGVKHAFPRTPLEGHRKGHDLEGTHHPPSTKEGVEAEQRVPEARTQPKNPSQPPPVPA
KKSRERLANGLHPVLGGPGGTLPSPDAPCLPVKRGSPTSPASPSDCPPALAARPPSGQEP
GSPPSTRPPPWLSELPESASLQEHGVKLGPALTRKVSCARGVDLEMLTENKLHAEGIDLT
EEPYSDKHGRCGIPEALVQRYAEDLDQPERDVATNMDQIRVKLLRKQHRMAIPSGGLTEI
CRKPVSPGCIASVSDWLVSIGLPMYTGTLSAAGVSTLSRVPSLSHTCLQEAGITEERHIR
KLLSAARLFKLPPGPEAM
Download sequence
Identical sequences ENSMICP00000013211 ENSMICP00000013211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]