SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014098 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014098
Domain Number 1 Region: 292-641,672-739
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 3.36e-159
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000537
Further Details:      
 
Domain Number 2 Region: 6-214
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 3.27e-70
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014098   Gene: ENSMICG00000015459   Transcript: ENSMICT00000015470
Sequence length 789
Comment pep:novel genescaffold:micMur1:GeneScaffold_3351:73764:115179:1 gene:ENSMICG00000015459 transcript:ENSMICT00000015470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLA
AETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNDRHSPMVAKST
LDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHE
EDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRPGAFAIY
LEPWHSDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQEWSLMCPNECPGLD
EVWGEEFEKLYESYEKEGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNL
GTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVIVRNLNKI
IDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESPEAQLLNKQIFETIYYGAL
EASCDLAKEHGPYETYQGSPVSKGILQYDMWNVTPTDLWDWKLLKEKIAKYGIRNSLLIA
PMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWDEKMKNQII
ACNGSVQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKL
TSMHFYGWKQGLTMYYLRTPAANPIQFTLNKEKLKDKEKISKEEEEKERNTAAMVCSLEN
RDECLMCGS
Download sequence
Identical sequences ENSMICP00000014098 ENSMICP00000014098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]