SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014516 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014516
Domain Number 1 Region: 73-181,211-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.36e-47
Family BAR domain 0.0029
Further Details:      
 
Domain Number 2 Region: 265-297,329-386
Classification Level Classification E-value
Superfamily SH3-domain 2.61e-17
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014516   Gene: ENSMICG00000015928   Transcript: ENSMICT00000015926
Sequence length 387
Comment pep:novel genescaffold:micMur1:GeneScaffold_2995:1395836:1441480:1 gene:ENSMICG00000015928 transcript:ENSMICT00000015926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIMDFNVKKLAADAGTFLSRAVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXARIEEFVYEKLDRKAPSRLNNPELLGQYMIDAGTEFGPGTAYGNALIK
CGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAEARNSXXXXXXXXXXXXXIWAEEVTKSEQELRITQSEFDRQAEITRLLLEGISST
HAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSSYLCNNNQTSATPTPSILPNVI
VCSAMASTSGLVITPPPANLNDIKEYNGSRKARVLYDYDAANSTELSLLADEVITVFSVV
GMDSDWLMGERGNQKGKVPITYLELLN
Download sequence
Identical sequences ENSMICP00000014516 ENSMICP00000014516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]