SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015949 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015949
Domain Number 1 Region: 45-333,518-581
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.13e-88
Family FAD-linked reductases, N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 340-522
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.44e-58
Family GMC oxidoreductases 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015949   Gene: ENSMICG00000017511   Transcript: ENSMICT00000017511
Sequence length 601
Comment pep:novel genescaffold:micMur1:GeneScaffold_2830:470192:476147:-1 gene:ENSMICG00000017511 transcript:ENSMICT00000017511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCALRGWRQGLLGLHGALARGALGQRQLPGLWARALASMGPQSGDEYSYVVVGAGSAGC
VLARRLTEDPSEHVLLLEAGPRDLYAGSKRLLWKIHMPAALVANLCDNRYNWCYHTEPQP
GLDGRVLYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHRQGAEGWDYAHCLPYFRKAQGH
ELGASRYRGGDGPLRVSRGKTNHPLHQAFLEAAQQAGYPLTEDMNGFQQEGFGWMDMTIH
EGKRWSTACAYLHPALSRPNLRAEARTLVSRVLFEGTRAVGVEYVKNGRSHRAYASKEVI
LSGGAINSPQLLMLSGVGNADDLKKLGIPVVCHLPGVGQNLQDHLEVYVQQACTRPITLH
SAQKPLRKACIGLEWLWRFTGDGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRV
PTQEDAYQVHVGTMRGTSVGWLKLRSANPQDHPVIQPNYLSTEADVEDFRRCVKLTREIF
AQEALAPFRGKELQPGSHVQSDEEIDAFVRAKADSAYHPSCTCKMGQPSDPAAVVDPQTR
VLGVESLRVVDASVMPSVVSGNLNAPTVMLAEKAADIIKGRPALWDEDVPVYKPRTLDTQ
R
Download sequence
Identical sequences XP_012627081.1.48125 XP_012627082.1.48125 ENSMICP00000015949 ENSMICP00000015949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]