SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CIHT_05461 from Coccidioides immitis H538.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CIHT_05461
Domain Number 1 Region: 54-163
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00000000000141
Family Polyphosphate kinase C-terminal domain 0.058
Further Details:      
 
Domain Number 2 Region: 8-55
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000000895
Family Nuclease 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CIHT_05461
Sequence length 733
Comment | CIHG_05435 | Coccidioides immitis H538.4 phospholipase D2 (734 aa)
Sequence
MYDREVVPRMPWHDIAMHVVGQPARDLTRHFVQRWNYILRQRKPTRPTPFLLPPPDFNPA
DLEALGLDGSCEVQVLRSSSTWSTGTPEVTEHSIMNAYVKMIEKSEHFVYIENQFFVSSC
EVEGKKIENLIGDALVERIVRAARNEEDWRAVILIPLMPGFQNTVDTEGGTSVRLIMQCQ
YRSICRGETSIFGRLRAQEHLGVDVDEIMEQEMGGEVESRKSRQENSDSCASEGPRDTDN
WGEREDEREILERRHRLQDEFLARSEDMHSFNHDVDWEQANNPNLKSNRKLTADARVTRN
ASHRKDLEGFGVDQMQILHEAGQITGRDSFLGQDNVEYLKEVDVNEKQKLQKDSKQRSDS
RLPTPSELNTQEEDHPSILEAANSPADVLNQQQMAFHNDDAASNQPTQANPLTQSNNCHL
MLPASARPIIDKDCMKDPLCDAFYLDTWQAIAENNTKVFRMVFRCMPDSEVKSWKEYKEY
TAYAERFADMQNNYFYDENAPHLQPSGGSKLQSGPPGAGVTSTVGKVGHDVEKIGSEAKQ
VVANHLSNEASAEDSLKQWAAEANRAQIERQQEELAKVETLGEKEALKAVETKSSQSSGN
VEPSVAFPDVDKALERQRSGAQTNGYPDALALNGSLSQRRRRRGTTRSSKREFHASDDII
SMHEAEELLGMVQGHLVLWPYEWCARARKSKGVIGYIHSIKSPLWKYITKNIHSKRSPKW
YLIHFCSTTADSV
Download sequence
Identical sequences A0A0J8RW06
CIHT_05461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]