SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CIRT_07733 from Coccidioides immitis RMSCC 2394

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CIRT_07733
Domain Number 1 Region: 88-217
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000000122
Family Glutathione S-transferase (GST), C-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 16-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000134
Family Glutathione S-transferase (GST), N-terminal domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CIRT_07733
Sequence length 258
Comment | CIRG_07728 | Coccidioides immitis RMSCC 2394 conserved hypothetical protein (259 aa)
Sequence
MASGTEKEYTVIGAWTRYSSWTARVTTLLDFYEIPYEAVITSLEEATKLSHSGLAPALTV
RSLGEDIQVNDSLAILEFLAEAHPDLPFWPKDRALRALARSAVARMHSGLCRTLQATCGT
NFLGQYTGNVPISDDAIVEAKRTLALWSQLRKKTAERLKELGQDDKGFLFGEFGIADSVF
WPVLWRFRSYGLPLDSATPEALAWMRQMWAHPKMKAIQQGYHRQGKRAETAIPAYDNIFK
DRLDVQYSWFPEDWELTP
Download sequence
Identical sequences A0A0J6YLP2 A0A0J8RJD8 J3KC53
CIMG_03806T0 CIRT_07733 XP_001244365.2.59393 CIHT_03045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]