SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CIRT_01084 from Coccidioides immitis RMSCC 2394

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CIRT_01084
Domain Number 1 Region: 56-215
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.95e-53
Family NQO2-like 0.0000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CIRT_01084
Sequence length 264
Comment | CIRG_01082 | Coccidioides immitis RMSCC 2394 NADH dehydrogenase flavoprotein 2 (265 aa)
Sequence
MASKLLPFTLRQCRQSFRHIPVRQCRQFTAATPVLSDILAVHRNTPENNPSIPFKFSEQN
LKVIDEILKRYPPQYKKAAVMPLLDLGQRQLGWTSISVMNEVARILEMPPMRVYEVATFY
TMYNREPVGKYFVQICTTTPCQLGGCGSDKIVEAITKHLGVSSHGQTTPDKLFTVLEVEC
LGACVNAPMVQINDDYYEDLTPETAVQLLNALKESALAGESGKKVNIPSPGPMSGRESCE
NSAGLTSLTSPLWSTETLRKDGEL
Download sequence
Identical sequences A0A0J7AUE7 A0A0J8RFQ7 J3KI96
CIRT_01084 CIMG_01025T0 XP_001247254.1.59393 CIHT_01241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]