SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CIRT_01509 from Coccidioides immitis RMSCC 2394

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CIRT_01509
Domain Number 1 Region: 179-268
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000003
Family Thioltransferase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CIRT_01509
Sequence length 450
Comment | CIRG_01507 | Coccidioides immitis RMSCC 2394 conserved hypothetical protein (451 aa)
Sequence
MEYPNQVARSISYPSFVIILPPTIVAPRMCRCKPTQRHSRADNLINHAESRTEVLGGQPR
IFRDTYFPIPHHPPGYVHEQSQKRKLGPRAPCRRLTFAQPPNLLPFTAPSLQGPTNDVIT
SWSLLLSHRLRNAELQNSLHRTSSTTKHTRSKLRYLSLRPSKPQIHQVMPDQTPSYSFDD
PTLYLFTSLTAGSSHIITATSRLETILKANKIGFRAIDVATDDKARMLWGRRSKGRKLPG
LVRYGNIVGDIVQIEEWNEYGELKDQLRGDPTSAALAAADISPVPSSTNTPSNKPPSATL
FPPSTTSSSPHIQIVGTPSRTPSAQSKQAERLTLALKQASEEAAAKAKENTRTKLNAVSP
SSTQGAEQAAAEMTTSTTTTTTGEEKPAVKTEAEGLKPEEGSQPTLKSEEKREEGGPSPS
PLQDDAEEKEKQDAKDTDSGEKEASNVDNK
Download sequence
Identical sequences A0A0J7AVJ2 A0A0J8QMG7
CIST_10160 CIRT_01509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]