SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CIRT_09546 from Coccidioides immitis RMSCC 2394

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CIRT_09546
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.8e-26
Family ArsC-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CIRT_09546
Sequence length 159
Comment | CIRG_09541 | Coccidioides immitis RMSCC 2394 conserved hypothetical protein (160 aa)
Sequence
MFRFHKPLDIITLFHKPALPSSLRALALLKQASANAAETATIDQASDHSAQNKLERQRRE
QFDLTVTEEPPTPDQLKLIMDYMAAGAGNGGVGAGKPGDLVSGARDRLDALRRLKEDGER
FVRPVVVDWNNGKAVLGTNESAILKLLQDEPPHTPDDTA
Download sequence
Identical sequences A0A0J6FLK9 A0A0J6YL38 A0A0J8QVH7 A0A0J8ULN1 C5NZG5 E9D499 J3K0N6
CIMG_10026T0 CIHT_06293 CPAT_07587 CIST_04747 222929.C5NZG5 CPSG_04438T0 XP_001239004.1.59393 XP_003072003.1.1890 CIRT_09546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]