SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CIST_00320 from Coccidioides immitis RMSCC 3703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CIST_00320
Domain Number 1 Region: 1065-1222
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.15e-24
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 738-910
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 2.62e-18
Family Pseudo ankyrin repeat 0.047
Further Details:      
 
Domain Number 3 Region: 150-181,383-439,471-521,600-626,675-699
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000174
Family Ankyrin repeat 0.0055
Further Details:      
 
Domain Number 4 Region: 92-235
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000129
Family Ankyrin repeat 0.008
Further Details:      
 
Weak hits

Sequence:  CIST_00320
Domain Number - Region: 872-1006
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0145
Family Ankyrin repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CIST_00320
Sequence length 1563
Comment | CISG_00319 | Coccidioides immitis RMSCC 3703 hypothetical protein (1564 aa)
Sequence
MEMNNHTFSSRKRLEELAASVGVSMSNYLPILKRNAISSFSHQDKEAAESLATRKRLETF
SSKSHIFRRTPSQRNFKKQELYVAIETVIRENGPVGVLECLVTQAKDAKSKKNIFKTDTQ
EFHVGPLLELAIGHRRADMVSILAPQADPASVNSCLRCATASANLDCVKALLENGADPNS
CQEEFIENITSGNIPLVKLLLRAEKRLNISCLDEALPIVQGANADSAGLFESVVEGGRID
LIAAFVSAKRPPSPASLSRALGVVLRGSTVVTEEQRLIIEMLLCAGASGENVNKILMRSI
STNDGNLASTVVSYREVISYDPSDAIIEAVKKNDMEILSIIFNGKLDSDCASALLAKFSK
VSVTLASSRKLWIVSTLVKYGATGSPLHEYLVNSVQRNDELLVRFLVDHGASVDYQDAKA
LRLAMSSKNLQIFKKLLGGKPSQPSFSLFFRLLPTLPPNLQLDLASELLAAGAQGQEVDK
TLARVFSDNVTLERHQFLELLVRHGADVNIKDGYCFQEAARLGDIVSLSILLKGSLSELS
LCRALTPASKLSPKELRFTIVDLLLSAGARGPIVDAQLVELVQEIPVDIVLISLVLEKGE
ANINMDGGKPVHHACRKADYKLLELLLQYRPTTKTLDAAFLTATSLEDPAVRYEICHKLL
NAGVKGAMLDKSLICEQQSPSSNMSLLELLIDHGANINFNNGAAIRNAIKQSDEQQLVLF
ASRMPSRQTVMGGLELLLRTNTVKRYEMANILLNATDISVSEALNPMLPEVIRLDIRNHR
LLKLFIQHGASVDYQQGMAIRKSIDNDYIDACELLLGQPVSSDTLETVFGSCLAIEGPRR
VQYTKLVLQAGFDGRCVDEALLKIVQEKPCDMDMVILLLAHGASVHFANSQCIVHAALSR
DDLILRIILESVSDKIAVTYAFGKTISAGITWLSASGLPTIELLLRHGATGEALNLALIA
AVGNAAMNPEVAKFVDLFLEFGARADYHDGRALRAAISKGQISLTKKIMDTCPSSKSLAI
GLTCVFSSDLSEDADVDAVDTLWCSDGLQKESPVLLCLQKWPRGTKILEKLLQSGMNVNQ
ITSYTIENDHGLEHVSLLLWALLQPKQRISSYAIECLLKHGADPNFQSTGSWKSPLLIAS
IERTPDVVLQLIHHGADVSRGDAAGKTPLFYASRRNQIDIIRHLIDAGATVDDGSLHEAA
QALSPDAVQLLISYGHDPNFPSMLHDGRCALANLSLHASDARLPVSGIRKTIDALIAGKA
DLRAQSQGKSLLFHALDNLGACVHVTTALLASGMWKLINDSCNIFTSNNYVYSPSMYIKK
NLQSSPRELGPQLLHILKAHNCRDVYYRLTSPQPPDMVNAPPEIMAEESRRQARVKRLQD
QEEEHQMQLRQNEDLANQQDILMTRTHNLRIQHDRELADEREANAERFAKQQLRLDAESA
AQRSRLAQQNRMLEFEHTKTLSQLRLQALEQQGRLQIANAQEVARIEQELVDKKLTTEIQ
RIRELEAANDRQYKRDADILCRQERLWAERKGIMSEDRGITPGNASGTMSPVKGLTYQGA
ELD
Download sequence
Identical sequences A0A0J8QHT7
CIST_00320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]