SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPSG_04542T0 from Coccidioides posadasii str. Silveira

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPSG_04542T0
Domain Number 1 Region: 6-112
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.84e-18
Family alpha-D-mannose-specific plant lectins 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPSG_04542T0
Sequence length 114
Comment | CPSG_04542 | Coccidioides posadasii Silveira mannose-binding lectin (115 aa)
Sequence
MSHSTLGNGEWLLKGNSLFSEDRSVEFKMQEDGKIAVYWGGQCRFQNTSHQSYNMKGIKM
EKDGVLRMYDDNDKVVWETKLEGAGDSTVICAVQNDGNVVLYRGTPIWASHTQK
Download sequence
Identical sequences A0A0J6FQQ3 C5NZN0 E9D301
222929.C5NZN0 XP_003072068.1.1890 CPAT_07698 CPSG_04542T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]