SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPSG_07583T0 from Coccidioides posadasii str. Silveira

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPSG_07583T0
Domain Number 1 Region: 28-256
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.35e-65
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0001
Further Details:      
 
Domain Number 2 Region: 228-361,392-464,518-557
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.23e-63
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0000902
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPSG_07583T0
Sequence length 559
Comment | CPSG_07583 | Coccidioides posadasii Silveira tyrosyl-DNA phosphodiesterase (560 aa)
Sequence
MARPLPSEAPRANHSEPIGIKTGLNVISSPVQLTHIRDLSEKSTYNCDTVTLQDILGDPL
IKECWQFNYLFDIDFLMKQFDPDVKNLIRIRVVHGSWKKDSANRIYIDEACARYQNVEPI
IAYMPEPFGTHHSKMMILIRHDDCAQIIIHTANMIPGDWANMCQGVWRSPLLPLLPLDRD
YDQSISGIIGSGRRFKRDILAYLDAYGRKKTGPLVEQLKKYDFDEVRAALIASVPSRQEI
PNLDSQKKTIWGWPAVQDVLRQIPTHKQLSCEPEKPRIVIQISSIASLGQTDKWLKDTFF
NALCPPSAAARFSIIFPTPDEIRRSLNGYRSGGSIHMKLQSAAQQKQFDYMRPYLCHWAG
DCENNQNADIEKSVSSTVTLDESTPNNTFVREAGRRRAAPHIKTYIRFSDAEDMRTIDWA
MVTSANLSTQAWGAAINANQEVRVCSWEIGVLVWPDLFLNDPQTADRDDKMLSKAYERGE
YAQMIPCFRQNAPCLSEVERLELEEPSRGDDKSKAWKTLVGFRMPYNLPLKPYSSRDIPW
CATATHTEPDWLGQTWEEG
Download sequence
Identical sequences E9DCN1
CPSG_07583T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]