SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPSG_08771T0 from Coccidioides posadasii str. Silveira

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPSG_08771T0
Domain Number 1 Region: 1124-1268
Classification Level Classification E-value
Superfamily SET domain 3.01e-48
Family Histone lysine methyltransferases 0.0026
Further Details:      
 
Domain Number 2 Region: 242-321
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000173
Family Canonical RBD 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPSG_08771T0
Sequence length 1271
Comment | CPSG_08771 | Coccidioides posadasii Silveira histone-lysine N-methyltransferase (1272 aa)
Sequence
MSRAPAGFADFFPTAPSVLQKKRSKAAQDRHAANTPKAADPLPNLGLSSTPDIKGGVGTS
ADNPVRAVGERSAETTLALGDTNGATSSSSLSTGSSGFFSASAPPGVAKPNGISSCALTP
LTNTDSSPPCKIESPLGSKSGSTDAAPQLAPTCEAHGGPEPVTITPLHTPPTPRVQARPA
NSEVKGHKITYDPDLDRKFPSKDRRRKPQYETFGVDDEKDPPPCDPRMAIANYTRGAACK
QKTKYRPTPYILRPWAYDPTTSVGPGPPTQIVVTGFDPLTPIAAISALFSSFGDIGEINN
RTDPMTGRFLGVCSIKYKDSRAFRGGISLSASQAVRRAYLECKKEQRIGTRRIRVELDRN
GVVSGRMVAKLITAQKSEFPSLEESRKESVGNNDNRLPIGEGAKKDNEQSKDNLPPSTAP
KGPSGRSSLHPSLLAPDGPRAVLKSPVPSRIEETPILQQIKRDPYIFIAHCYVPVLSTTV
PHLERRLKLYDWKAVRCDKTGYYIVFENSRRGELEAERCYRMCHMTALFTYVMNMECQPY
GNPNYERSPSPERIKAEKREKAKRERLHREMELDIEEEKRLRVENLDPAREALSVLIIEL
RDKLLDDVKSRVAAPALYDFLEPDRHNAKRQQLGIPAPEGTGRPSFRIDASTDGTVVHSQ
SDAYSRHHRPGGVSSLNVLALPRIRKVKGFEQGNAVYIDERRRAKPRKREFRPLYHRLQQ
LHEIEDSDDDQQVSFARDTEEVESRPLSRLSSESAESDNEDDLMRKIPSLLDAKPLDVPL
PESESLAGGIEQSGLPDREKSIIEELERGINTLPTSSKKRKRLIEELATRKKRKEVDNLF
ELDAKPLESLVEETAQEALPADSTDALRTVTPVPKDKKRKVKGQSGKQIFEERQAPKRKE
IDSTQPLLFEESVELLPEGEIEISEPAIEELKPEVEWGVSTDEPRPTAEDDDTIVLDLDG
WQSLIKDDEDINFLKKALSEHLAADIGNLAAWTWKHKEIKAINRGGDRGPVHSETRVDGY
YVPNPSGSARTEGRKRIRESEKSKYLPHRIKVQKAREERLAKAKNDPHAAAAEAARLLAA
KSLSKSTSRSTRVNNRRLIADINAQKQALPMQNGDSDVLRFNQLKKRKKPVRFARSAIHN
WGLYAEENISANDMIIEYVGEKVRQQVADMRERRYLKSGIGSSYLFRIDENTVIDATKRG
GIARFINHSCTPNCTAKIIKVDGSKRIVIYALRDIDRDEELTYDYKFEREWDSDDRIPCL
CGSAGCKGFLN
Download sequence
Identical sequences E9DG22
CPSG_08771T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]