SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000006 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000006
Domain Number 1 Region: 276-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000488
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 2 Region: 236-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000596
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000006
Domain Number - Region: 320-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000975
Family Classic zinc finger, C2H2 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000006   Gene: ENSDORG00000000007   Transcript: ENSDORT00000000007
Sequence length 437
Comment pep:novel scaffold:dipOrd1:scaffold_25914:16266:17580:-1 gene:ENSDORG00000000007 transcript:ENSDORT00000000007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQASLSVARSTDSPIILEPLSKSDYRNNLPQVVPVSSSELHSPLVTFTSSWHQPGRATLS
VEGVNESPCVAKQCSSEVSSLNPQTLEFSDGHTGRYSSALSPSGAFHIVNPHQIPPSNGI
HASLNHLQTGASFPKDNVHFKPLHLNPGSNNVLAKPDFANLESPDNTSDPNKGNLVVLLS
DFYYGQHKGDGQPKQKTYTTFKCLSCLKVLKNVKFMNHVKRHLEFEKQWSDSWENPTTCQ
HCHRQFPTPFQLERHIDNVHTTQELSTVCRICELSFETDQLLLEHMKDNHKPGELPYVCQ
VCNYRSSVFADVETHFRKCHANTKNLLCPFCLKIFKAGTPYVCHFRGHWERNVHRCSKCR
LQFLTFKEKMEHKTRYHQMFKKPKQLEGLPPETKVVIQVSLGPVQPGSEKVASITVSTTD
SEPSSPSPKSKKSKKKH
Download sequence
Identical sequences ENSDORP00000000006 ENSDORP00000000006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]