SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000066 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000066
Domain Number 1 Region: 718-775
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000486
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 27-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000811
Family Somatomedin B domain 0.0031
Further Details:      
 
Domain Number 3 Region: 63-136
Classification Level Classification E-value
Superfamily E set domains 0.0000182
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000066   Gene: ENSDORG00000000076   Transcript: ENSDORT00000000077
Sequence length 821
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1048:140731:149632:1 gene:ENSDORG00000000076 transcript:ENSDORT00000000077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAPLPWILLLLVIVSGPGPRPTAGAQESCSLRCGDQNGPCSCHPTCSGLGTCCSDFRDF
CLEISPSSGSMMGGKDFVAHFKWFGSTDGVICRFKESIQTLGYVDALKVHCVSPLLYESG
RIPFTISMDNGRTFTHSTWLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXRPYSANWTAKWSYLYPVATNISNSGFFTFTPKPAPLEYQKWK
VGALRIISSKNYAGQNDVQALWTNDHALAWHLGDDFRADSVAWARTQCLAWENLEDQLPD
FLKELPDCPCTLAQARADTGRFFTDYGCDIEHGSVCTYHPGAVHCVRSVQASPKYGSGQQ
CCYTKAGTQLLTADSTGGSTPDRGHDWGAPPYRTPPRVPGMSHWMYDVISFYYCCLWAPE
CHRYMRRRPSSDCRSYQPPHLASAFGDPHFVTFDGTNFTFNGRGEYVLLEGALTDLRVQV
RAQPERTDHGTETRGTRLTAVAVQEGNSDVVEVRLVGTPVILEVLLNQEVLSFTEQSWMD
LKGMFLSVASENKVSIMLSSGAGVEVSLQGSFLSVAVLLPEKFLTHTHGLLGTLNNNPTD
DFTLRNGQVLPWNASAQQLFQFGADWAVHNTSSLFTYDSWMLVYNFMNQPKHDPNFKPLF
PDEATLDPTQAEEATKLCANNPFCIFDVAVTGSLSVGNATRVSYQQHQDRLKNLQPVVSC
GWLAPPSNGYKEGSRYLMGSTIRFGCNSGYSLAGAETSTCQANGAWSAASPECHIGRNYT
VLLSIIFGGLAVALLIAVIYVLLRRKKGHMNMWSSQPGRNT
Download sequence
Identical sequences ENSDORP00000000066 ENSDORP00000000066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]