SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000099 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000099
Domain Number 1 Region: 548-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-18
Family Classic zinc finger, C2H2 0.00064
Further Details:      
 
Domain Number 2 Region: 363-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-16
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 3 Region: 264-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000123
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 475-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000309
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 436-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000074
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000099   Gene: ENSDORG00000000111   Transcript: ENSDORT00000000111
Sequence length 724
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1287:15:23592:1 gene:ENSDORG00000000111 transcript:ENSDORT00000000111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGEAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQM
VMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPV
PVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQ
GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEV
NAEKVVGNMKPPKPTKIKKKGVKKTFQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCG
RAFRTVTLLRNHLNTHTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG
TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERY
ALIQHQKSHKNEKRFKCDQCDYACRQERHMIMHKRTHTGEYACSHCDKTFQKQLLDMHFK
RYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKRKMR
SKKEDSSDSENAEPDLDDNEDDEEPAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTNQPK
QNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEMILS
MMDR
Download sequence
Identical sequences ENSDORP00000000099 ENSDORP00000000099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]